PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017875m
Common NameCARUB_v10017875mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 258aa    MW: 29742.3 Da    PI: 9.3935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017875mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-18855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed llv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Carubv10017875m  8 KGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding56.28.2e-1861106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  Carubv10017875m  61 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.196355IPR017930Myb domain
SuperFamilySSF466895.03E-307102IPR009057Homeodomain-like
SMARTSM007175.2E-16757IPR001005SANT/Myb domain
PfamPF002499.5E-17855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-21962IPR009057Homeodomain-like
CDDcd001671.45E-111055No hitNo description
PROSITE profilePS5129427.81456110IPR017930Myb domain
SMARTSM007172.2E-1760108IPR001005SANT/Myb domain
PfamPF002492.9E-1661105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2463109IPR009057Homeodomain-like
CDDcd001672.60E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MMQEENRKGP WTEQEDILLV NFVHLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK  60
RGKMTPQEER LVLELHAKWG NRWSKIARKL PGRTDNEIKN YWRTHMRKKA QEKKRPMSPT  120
SSFSNCSSSS MTTTTTNTQD TSCHSRKSSG KVSFYDTGGS RSTGDMMMNQ ETEDVYSMDD  180
IWREIDHSPV NTIKPVKDIY SEHSHCLSYS TLASPTWESS LDSIWNMDGD KSKMSSSFGN  240
DQFPFCFQHS RSPWSSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2881104105MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-28811058159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-28811058159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-2881104105C-Myb DNA-Binding Domain
1msf_C3e-2881104105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727330.0AF272733.1 Arabidopsis thaliana putative transcription factor (MYB48) mRNA, complete cds.
GenBankAY5195940.0AY519594.1 Arabidopsis thaliana MYB transcription factor (At3g46130) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291710.10.0hypothetical protein CARUB_v10017875mg
SwissprotQ9LX821e-161MYB48_ARATH; Transcription factor MYB48
TrEMBLR0HL370.0R0HL37_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50010971e-165(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.11e-153myb domain protein 48